Isolation and structures of alligator gar (Lepisosteus spatula) insulin and pancreatic polypeptide
| Autor: | Joe R. Kimmel, Valentine A. Lance, J.W. Hamilton, Kurt E. Ebner, Allen B. Rawitch, H.G. Pollock, J.B. Rouse |
|---|---|
| Rok vydání: | 1987 |
| Předmět: |
Macromolecular Substances
Molecular Sequence Data Peptide Lepisosteus Pancreatic Polypeptide Alligator gar Homology (biology) Islets of Langerhans Endocrinology Species Specificity Sequence Homology Nucleic Acid medicine Animals Insulin Pancreatic polypeptide Amino Acid Sequence Peptide sequence chemistry.chemical_classification biology Fishes biology.organism_classification Neuropeptide Y receptor Peptide Fragments medicine.anatomical_structure chemistry Biochemistry Animal Science and Zoology Pancreas |
| Zdroj: | General and Comparative Endocrinology. 67:375-382 |
| ISSN: | 0016-6480 |
| DOI: | 10.1016/0016-6480(87)90192-4 |
| Popis: | Insulin and a 36-residue peptide with homology to pancreatic polypeptide (PP) were isolated from the endocrine pancreas of the alligator gar (Lepisosteus spatula), a ganoid fish, by gel filtration and HPLC. Heterologous radioimmunoassays were used to detect insulin-like and PP-like immunoreactivities during purification of the two peptides. The sequence of the 36-amino acid peptide containing a C-terminal tyrosinamide was identical at 31 of 36 positions to porcine neuropeptide Y (NPY). The amino acid sequence of this peptide is YPPKPENPGEDAPPEELAKYYSALRHYINLITRQRY-NH2. The second peptide, gar insulin, contains 52 amino acid residues and is composed of a 21-residue A chain and a 31-residue B chain. The sequence of the A chain is GIVEQCCHKPCTIYELENYCN. The sequence of the B chain is AANQHLCGSHLVEALYLVCGEKGFFYNPNKV. |
| Databáze: | OpenAIRE |
| Externí odkaz: |
|