Zobrazeno 1 - 10
of 25
pro vyhledávání: '"V G, Arzumanian"'
Publikováno v:
Журнал микробиологии, эпидемиологии и иммунобиологии, Vol 97, Iss 1, Pp 19-25 (2020)
The aim was to study the effect of rabbit immunization with different yeasts cells on overall antimicrobial serum activity and specific activity of antimicrobial peptides fraction.Material and methods. Rabbits were immunized with cells of Candida alb
Externí odkaz:
https://doaj.org/article/bea52d644c9043279f88e08fc24aa9e5
Autor:
V. G. Arzumanian, V. A. Zaborova, I. V. Il'ina, A. Yu. Mironov, I. S. Lepetinsky, G. V. Vasilyeva
Publikováno v:
Russian Clinical Laboratory Diagnostics. 67:607-612
Despite of great number of investigations in the area of tinea pedis, question is opened: to what extent dermatophyte fungi are spread among modern population and does their occurrence interrelated with host age? Investigated group included 99 volunt
Publikováno v:
Журнал микробиологии, эпидемиологии и иммунобиологии, Vol 97, Iss 1, Pp 19-25 (2020)
The aim was to study the effect of rabbit immunization with different yeasts cells on overall antimicrobial serum activity and specific activity of antimicrobial peptides fraction.Material and methods. Rabbits were immunized with cells of Candida alb
Publikováno v:
Klinicheskaia laboratornaia diagnostika. 66(6)
Histatins are the most significant antimicrobial peptides (AMP) of saliva and there are 12 types of such AMP. Histatin molecules contain relatively high percent of histidine and tyrosine residues. This property allows to use well known from organic c
Autor:
Ya. V. Makarova, Irina V. Shelukhina, Igor Ivanov, Maxim N. Zhmak, O. P. Bychkova, V. G. Arzumanian, A. S. Budikhina, L. S. Balyasova, A. S. Trenin, Victor I. Tsetlin
Publikováno v:
Russian Journal of Bioorganic Chemistry. 45:89-100
Polypeptide SE-33 (SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFF), which is a retro analog of natural antimicrobial protein cathelicidin LL-37 ([LL-37, 37 aa]), was synthesized by the method of solid-phase peptide synthesis. Similar to the
Publikováno v:
Russian Clinical Laboratory Diagnostics. 64:351-353
Role of bacteria Staphylococcus spp., yeasts of Candida spp., Malassezia spp. genera in pathogenesis of atopic dermatitis (AD) in infant patients is well known. However, no data concerning the incidence of dermatophytes in such disease entity were ob
Publikováno v:
Bulletin of experimental biology and medicine. 168(6)
The effects of vaginal secretion, its antibacterial peptide fraction, albumin, and bacterial metabolites on the spermatozoon membranes were studied. Vaginal secretion was collected from healthy women; the fraction of antibacterial peptides was isolat
Publikováno v:
Klinicheskaia laboratornaia diagnostika. 64(6)
Role of bacteria Staphylococcus spp., yeasts of Candida spp., Malassezia spp. genera in pathogenesis of atopic dermatitis (AD) in infant patients is well known. However, no data concerning the incidence of dermatophytes in such disease entity were ob
Autor:
V. A. Zaborova, Konstantin G. Gurevich, E. E. Achkasov, M. V. Ivkina, A. G. Globa, V. G. Arzumanian
Publikováno v:
British Journal of Medicine and Medical Research. 8:266-275
Publikováno v:
Bulletin of experimental biology and medicine. 148(3)
Antagonistic activity of Malassezia yeast towards clinically signifi cant yeast species was studied. Ten Malassezia strains exhibited this activity. M. furfur strain exhibited maximum activity and the least sensitivity to “foreign” metabolites. M