Zobrazeno 1 - 8
of 8
pro vyhledávání: '"Stephanie L. Yung"'
Autor:
Kyle R. Simonetta, Joshua Taygerly, Kathleen Boyle, Stephen E. Basham, Chris Padovani, Yan Lou, Thomas J. Cummins, Stephanie L. Yung, Szerenke Kiss von Soly, Frank Kayser, John Kuriyan, Michael Rape, Mario Cardozo, Mark A. Gallop, Neil F. Bence, Paul A. Barsanti, Anjanabha Saha
Publikováno v:
Nature Communications, Vol 10, Iss 1, Pp 1-12 (2019)
Directed protein degradation to target hard-to-drug proteins is a promising therapeutic approach. Here, the authors report the prospective discovery of small molecule “molecular glue” that inserts into a naturally occurring E3 ligase-substrate in
Externí odkaz:
https://doaj.org/article/1987a6eabdf140cbaf14746bd1ee3135
Autor:
Paul A. Barsanti, Joshua Taygerly, Kathleen Boyle, Kyle R. Simonetta, Stephanie L. Yung, Szerenke Kiss von Soly, Chris Padovani, Frank Kayser, Neil Bence, Anjanabha Saha, Stephen E. Basham, John Kuriyan, Mark Gallop, Thomas Cummins, Yan Lou, Michael Rape, Mario G. Cardozo
Publikováno v:
Nature Communications, Vol 10, Iss 1, Pp 1-12 (2019)
Nature Communications
Nature communications, vol 10, iss 1
Simonetta, Kyle R; Taygerly, Joshua; Boyle, Kathleen; Basham, Stephen E; Padovani, Chris; Lou, Yan; et al.(2019). Prospective discovery of small molecule enhancers of an E3 ligase-substrate interaction.. Nature communications, 10(1), 1402. doi: 10.1038/s41467-019-09358-9. UC Berkeley: Retrieved from: http://www.escholarship.org/uc/item/26s7m3b9
Nature Communications
Nature communications, vol 10, iss 1
Simonetta, Kyle R; Taygerly, Joshua; Boyle, Kathleen; Basham, Stephen E; Padovani, Chris; Lou, Yan; et al.(2019). Prospective discovery of small molecule enhancers of an E3 ligase-substrate interaction.. Nature communications, 10(1), 1402. doi: 10.1038/s41467-019-09358-9. UC Berkeley: Retrieved from: http://www.escholarship.org/uc/item/26s7m3b9
Protein–protein interactions (PPIs) governing the recognition of substrates by E3 ubiquitin ligases are critical to cellular function. There is significant therapeutic potential in the development of small molecules that modulate these interactions
Autor:
Andrea Bell, Stephanie L. Yung, Ling Yang, Joanne M. Buxton, Clark Q. Pan, Thomas H. Claus, Hongxing Chen, James Whelan, Kevin B. Clairmont, Margit MacDougall, Irene Tom
Publikováno v:
Journal of Biological Chemistry. 281:12506-12515
The closely related peptides glucagon-like peptide (GLP-1) and glucagon have opposing effects on blood glucose. GLP-1 induces glucose-dependent insulin secretion in the pancreas, whereas glucagon stimulates gluconeogenesis and glycogenolysis in the l
Autor:
Stephanie L. Yung, Xianbu Peng, Yin Liang, Hongxing Chen, Fernando Dela Cruz, Ling Yang, Clark Pan, Jian Zhu, James N. Livingston, Thomas H. Claus, Sarah Hamren, Manami Tsutsumi, Yaxin Li
Publikováno v:
Diabetes. 51:1453-1460
Pituitary adenylate cyclase—activating peptide (PACAP) and vasoactive intestinal peptide (VIP) activate two shared receptors, VPAC1 and VPAC2. Activation of VPAC1 has been implicated in elevating glucose output, whereas activation of VPAC2 may be i
Autor:
Stephanie L. Yung, Y. John Wang, James Whelan, Dumas Michael L, Steve Roczniak, Fugang Li, Clark Q. Pan, Thomas H. Claus, Wayne A. Froland, Yaxin Li, Irene Tom, Wei Wang
Publikováno v:
The Journal of pharmacology and experimental therapeutics. 320(2)
A previously described VPAC2-selective agonist, BAY 55-9837 (peptide HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY), had several limitations with respect to its potential as an insulin secretagogue for the treatment of type 2 diabetes. These limitations were prima
Autor:
Margit MacDougall, Stephanie L. Yung, Clark Pan, Tracey Todd, Margaret Caudle, Sarah Hamren, Manami Tsutsumi, Shanafelt Armen B, Lynn Lemoine, Fernando Dela Cruz, Steve Roczniak, Jian Zhu, James W. Bloom
Publikováno v:
The Journal of biological chemistry. 278(12)
Pituitary adenylate cyclase-activating peptide (PACAP) has a specific receptor PAC1 and shares two receptors VPAC1 and VPAC2 with vasoactive intestinal peptide (VIP). VPAC2 activation enhances glucose-induced insulin release while VPAC1 activation el
Autor:
Manami, Tsutsumi, Thomas H, Claus, Yin, Liang, Yaxin, Li, Ling, Yang, Jian, Zhu, Fernando, Dela Cruz, Xianbu, Peng, Hongxing, Chen, Stephanie L, Yung, Sarah, Hamren, James N, Livingston, Clark Q, Pan
Publikováno v:
Diabetes. 51(5)
Pituitary adenylate cyclase-activating peptide (PACAP) and vasoactive intestinal peptide (VIP) activate two shared receptors, VPAC1 and VPAC2. Activation of VPAC1 has been implicated in elevating glucose output, whereas activation of VPAC2 may be inv
Autor:
Yonchu Jenkins, Tian-Qiang Sun, Vadim Markovtsov, Marc Foretz, Wei Li, Henry Nguyen, Yingwu Li, Alison Pan, Gerald Uy, Lisa Gross, Kristen Baltgalvis, Stephanie L Yung, Tarikere Gururaja, Taisei Kinoshita, Alexander Owyang, Ira J Smith, Kelly McCaughey, Kathy White, Guillermo Godinez, Raniel Alcantara, Carmen Choy, Hong Ren, Rachel Basile, David J Sweeny, Xiang Xu, Sarkiz D Issakani, David C Carroll, Dane A Goff, Simon J Shaw, Rajinder Singh, Laszlo G Boros, Marc-André Laplante, Bruno Marcotte, Rita Kohen, Benoit Viollet, André Marette, Donald G Payan, Todd M Kinsella, Yasumichi Hitoshi
Publikováno v:
PLoS ONE, Vol 8, Iss 12, p e81870 (2013)
Modulation of mitochondrial function through inhibiting respiratory complex I activates a key sensor of cellular energy status, the 5'-AMP-activated protein kinase (AMPK). Activation of AMPK results in the mobilization of nutrient uptake and cataboli
Externí odkaz:
https://doaj.org/article/9f3bbe0f39b0498d932c53dbf27c0985