Zobrazeno 1 - 10
of 20
pro vyhledávání: '"Shanyun Lu"'
Publikováno v:
Protein Science. 11:245-252
The three-dimensional structure of huwentoxin-II (HWTX-II), an insecticidal peptide purified from the venom of spider Selenocosmia huwena with a unique disulfide bond linkage as I-III, II-V, and IV-VI, has been determined using 2D (1)H-NMR. The resul
Publikováno v:
Journal of Virology. 80:2808-2814
In the replication cycle of nonsegmented negative-strand RNA viruses, the viral RNA-dependent RNA polymerase (L) recognizes a nucleoprotein (N)-enwrapped RNA template during the RNA polymerase reaction. The viral phosphoprotein (P) is a polymerase co
Autor:
Sándor Pongor, Jingchu Luo, Oliviero Carugo, Stefan Strobl, Xiaocheng Gu, Songping Liang, Shanyun Lu
Publikováno v:
Protein Engineering, Design and Selection. 14:639-646
The three-dimensional structure of the amaranth alpha-amylase inhibitor (AAI) adopts a knottin fold of abcabc topology. Upon binding to alpha-amylase, it adopts a more compact conformation characterized by an increased number of intramolecular hydrog
Autor:
Lisa Nagy, Alireza Arabashi, Jindrich Symersky, Haitao Ding, Shanyun Lu, Danlin Luo, Robert J. Bunzel, Lawrence J. DeLucas, Ming Luo, Shihong Qiu, Songlin Li
Publikováno v:
Acta Crystallographica Section D Biological Crystallography. 59:1106-1108
The C-terminal part of tropomodulin protein 1, isoform A, from Caenorhabditis elegans was expressed in Escherichia coli and purified to homogeneity. Optimized from the initial nanoscreen, crystals grew to dimensions of 0.25 x 0.15 x 0.15 mm at 277 K
Autor:
Kavita B. Hosur, Terry D. Connell, Shuang Liang, Hesham F. Nawar, Richard I. Tapping, Benjamin R. Weber, Shanyun Lu, George Hajishengallis
Publikováno v:
Journal of immunology (Baltimore, Md. : 1950). 182(5)
The pentameric B subunit of type IIb Escherichia coli enterotoxin (LT-IIb-B5), a doughnut-shaped oligomeric protein from enterotoxigenic E. coli, activates the TLR2/TLR1 heterodimer (TLR2/1). We investigated the molecular basis of the LT-IIb-B5 inter
Autor:
Shanyun Lu, Yanfeng Zhou, Xiaofeng Zheng, Xueyu Dai, Min Lian, Ying Jiang, Ming Luo, Yunjia Chen, Mo Zhou, Jingchu Luo, Qiang Chen, Xiaocheng Gu
Publikováno v:
Biochemical and biophysical research communications. 332(2)
Human secreted proteins play a very important role in signal transduction. In order to study all potential secreted proteins identified from the human genome sequence, systematic production of large amounts of biologically active secreted proteins is
Autor:
Shanyun Lu, Mike Carson, Songlin Li, Edward J. Meehan, Ming Luo, Jindrich Symersky, Liqing Chen
Publikováno v:
Proteins. 56(2)
Autor:
Dongling Li, Qi Zhu, Yucheng Xiao, Xiaocheng Gu, Meichi Wang, Xia Xiong, Zhonghua Liu, Shanyun Lu, Xia Xu, Songping Liang
Publikováno v:
The Journal of biological chemistry. 279(36)
Hainantoxin-IV (HNTX-IV) can specifically inhibit the neuronal tetrodotoxin-sensitive sodium channels and defines a new class of depressant spider toxin. The sequence of native HNTX-IV is ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH(2). In the present stud
Autor:
Rui Li, Hui Ren, Jianli An, Yu-He Liang, Lan-Fen Li, Xiaofeng Zheng, Haitao Ding, Xiao-Dong Su, Shanyun Lu, Shihong Qiu, Ming Luo
Publikováno v:
Acta crystallographica. Section D, Biological crystallography. 60(Pt 7)
The adrenal gland protein AD-004 was identified in the human adrenal gland. Full-length AD-004 contains 172 amino acids, with a predicted molecular weight of about 20 kDa. In attempts to crystallize human AD-004, the gene was subcloned into a modifie
Publikováno v:
Protein expression and purification. 32(2)
Hypoxanthine-guanine phosphoribosyltransferase (HGPRT, EC 2.4.2.8) from a newly characterized thermophile Thermoanaerobacter tengcongensis was expressed in Escherichia coli and purified. Analytical gel filtration suggested that the enzyme exist as a