Zobrazeno 1 - 10
of 57
pro vyhledávání: '"Pal'keeva ME"'
Autor:
Maria Sidorova, Alexander A. Timoshin, Irina Studneva, M. V. Ovchinnikov, L. I. Serebryakova, A. S. Molokoedov, A. A. Az’muko, Oksana Veselova, Oleg I. Pisarenko, Pal'keeva Me
Publikováno v:
International Journal of Peptide Research and Therapeutics. 27:2039-2048
Natural and chemically modified N-terminal galanin fragments (WTLNSAGYLLGPHA-OH (G1) and WTLNSAGYLLGPβAH-OH (G2), respectively) reduce functional and metabolic disturbances in the heart during experimental ischemia and reperfusion. The aim of this w
Autor:
A. A. Az’muko, A. S. Molokoedov, Maria Sidorova, M. V. Ovchinnikov, U S Dudkina, E. V. Kudryavtseva, D. V. Avdeev, Pal'keeva Me, Tatiana I. Arefieva, V. N. Bushuev, S. B. Grechishnikov
Publikováno v:
Russian Journal of Bioorganic Chemistry. 46:520-529
The solid phase synthesis (SPS) of the ingramon peptide antagonist of the human monocyte chemoattractant protein-1 (H-Asp-His-Leu-Asp-Lys-Gln-Thr-Gln-Thr-Pro-Lys-Thr-OH), which exhibited the anti-inflammatory activity, was optimized. Side products of
Autor:
A. S. Molokoedov, Pal'keeva Me, A. A. Az’muko, D. V. Avdeev, L. I. Serebryakova, M. V. Ovchinnikov, Oleg I. Pisarenko, Irina Studneva, O M Veselova, Maria Sidorova
Publikováno v:
Russian Journal of Bioorganic Chemistry. 46:32-42
The full-length rat galanin (GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2, G29) was prepared by the solid phase peptide synthesis using the Fmoc-strategy. The peptide chain was elongated both by one amino acid and by a fragment condensation. Fragments with the
Autor:
Aydar A. Ishmukhametov, R. Sh. Bibilashvili, Sidorova Mv, Pal'keeva Me, Liubov I. Kozlovskaya, U S Dudkina, A S Molokoedov, Alexey M. Egorov, Ye V Parfyonova
Publikováno v:
Biomeditsinskaia khimiia. 67(3)
Computer simulation has been used to identify peptides that mimic the natural target of the SARS-CoV-2 coronavirus spike (S) protein, the angiotensin converting enzyme type 2 (ACE2) cell receptor. Based on the structure of the complex of the protein
Autor:
A. S. Molokoedov, Pal'keeva Me, A. A. Az’muko, L. I. Serebryakova, Irina Studneva, M. V. Ovchinnikov, O M Veselova, Oleg I. Pisarenko, Maria Sidorova
Publikováno v:
Russian Journal of Bioorganic Chemistry. 45:353-360
New peptide analogs of galanin corresponding to fragments of the N-terminal sequence were synthesized by an automatic solid-phase method using Fmoc-technology. Incomplete cleavage of the Boc-protection from the Trp indole ring was found during postsy
Autor:
Irina Studneva, O M Veselova, Oleg I. Pisarenko, A. S. Molokoedov, M. V. Ovchinnikov, Maria Sidorova, Pal'keeva Me, R O Lubimov
Publikováno v:
Biochemistry (Moscow), Supplement Series B: Biomedical Chemistry. 13:167-172
The clinical application of the anticancer agent doxorubicin (Dox) is limited due to its cardiotoxic effect. Using the method of automated solid-phase peptide synthesis, we obtained a synthetic agonist of galanin receptors GalR1-3 [βAla14, His15]-ga
Autor:
Pal'keeva Me, M. V. Ovchinnikov, Irina Studneva, Maria Sidorova, O M Veselova, R O Lubimov, A. S. Molokoedov, Oleg I. Pisarenko
Publikováno v:
Biomeditsinskaya Khimiya. 65:51-56
The use of the anticancer drug doxorubicin (Dox) is limited due to its cardiotoxic effect. Using the method of automatic solid-phase peptide synthesis, we obtained a synthetic agonist of galanin receptors GalR1-3 [RAla14, His15]-galanine (2-15) (G),
Autor:
Oleg I. Pisarenko, Maria Sidorova, Oksana Veselova, Irina Studneva, A. S. Molokoedov, Pal'keeva Me, L. I. Serebryakova, M. V. Ovchinnikov, Radik Gataulin
Publikováno v:
Peptides. 111:127-131
Agonists and antagonists for galanin receptor subtypes GalR1-3 can be used as putative therapeutics targets for the treatment of various human diseases. However, effects of galanin and its N-terminal fragments on myocardial ischemia/reperfusion injur
Autor:
M. V. Ovchinnikov, L. I. Serebryakova, A. S. Molokoedov, Pal'keeva Me, Oleg I. Pisarenko, Irina Studneva, Oksana Veselova, Maria Sidorova
Publikováno v:
Biomedicine & Pharmacotherapy, Vol 109, Iss, Pp 1556-1562 (2019)
N-terminal fragments of galanin (2–11) and (2–15) are critical for binding to GalR1-3 receptors, members of the G-protein-coupled receptor superfamily, and are involved in myocardial protection against ischemia/reperfusion (I/R) injury. This stud
Autor:
A. A. Az’muko, M. V. Ovchinnikov, A. S. Molokoedov, Oleg I. Pisarenko, V. N. Bushuev, Pal'keeva Me, Maria Sidorova
Publikováno v:
Russian Journal of Bioorganic Chemistry. 45:18-26
A method for the solid-phase synthesis of the apelin-12 analog has been developed using the Fmoc methodology in combination with the temporary protection of the guanidine function of the arginine residues by protonation (salt formation) during the fo