Zobrazeno 1 - 10
of 83
pro vyhledávání: '"Oleg I, Pisarenko"'
Autor:
Maria Sidorova, Alexander A. Timoshin, Irina Studneva, M. V. Ovchinnikov, L. I. Serebryakova, A. S. Molokoedov, A. A. Az’muko, Oksana Veselova, Oleg I. Pisarenko, Pal'keeva Me
Publikováno v:
International Journal of Peptide Research and Therapeutics. 27:2039-2048
Natural and chemically modified N-terminal galanin fragments (WTLNSAGYLLGPHA-OH (G1) and WTLNSAGYLLGPβAH-OH (G2), respectively) reduce functional and metabolic disturbances in the heart during experimental ischemia and reperfusion. The aim of this w
Autor:
Irina M. Studneva, Oksana M. Veselova, Igor V. Dobrokhotov, Larisa I. Serebryakova, Marina E. Palkeeva, Alexander S. Molokoedov, Andrey A. Azmuko, Michael V. Ovchinnikov, Maria V. Sidorova, Oleg I. Pisarenko
Publikováno v:
Biochemistry. Biokhimiia. 87(4)
Neuropeptide galanin and its N-terminal fragments reduce the generation of reactive oxygen species and normalize metabolic and antioxidant states of myocardium in experimental cardiomyopathy and ischemia/reperfusion injury. The aim of this study was
Autor:
Arthur A. Bahtin, Irina Studneva, Galina G. Konovalova, Vadim Z. Lankin, Oksana Veselova, Oleg I. Pisarenko
Publikováno v:
Acta Naturae
The use of the anticancer drug doxorubicin (Dox) is limited by its cardiotoxic effect. The aim of this work was to study the effect of a new synthetic agonist of the galanin receptor GalR1-3 [Ala14, His15]-galanine (215) (G) on the metabolism, antiox
Autor:
A. S. Molokoedov, Pal'keeva Me, A. A. Az’muko, D. V. Avdeev, L. I. Serebryakova, M. V. Ovchinnikov, Oleg I. Pisarenko, Irina Studneva, O M Veselova, Maria Sidorova
Publikováno v:
Russian Journal of Bioorganic Chemistry. 46:32-42
The full-length rat galanin (GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2, G29) was prepared by the solid phase peptide synthesis using the Fmoc-strategy. The peptide chain was elongated both by one amino acid and by a fragment condensation. Fragments with the
Publikováno v:
Biochemistry. Biokhimiia. 86(10)
The design of new drugs for treatment of cardiovascular diseases based on endogenous peptide hormones is of undoubted interest and stimulates intensive experimental research. One of the approaches for development in this area is synthesis of the shor
Autor:
Roman O. Lyubimov, Mariya V Sidorova, Irina Studneva, Igor Vladimirovich Dobrokhotov, Alla K Tihaze, Galina G. Konovalova, Pal'keeva Me, L. I. Serebryakova, Alexandr S Molokoedov, Oksana M. Veselova, Vadim Z. Lankin, Alexandr A Timoshin, Oleg I. Pisarenko
Publikováno v:
Biochemistry. Biokhimiia. 86(4)
Antioxidant properties of rat galanin GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 (Gal), N-terminal fragment of galanin (2-15 aa) WTLNSAGYLLGPHA (G1), and its modified analogue WTLNSAGYLLGPβAH (G2) were studied in vivo in the rat model of regional myocardial
Autor:
A. S. Molokoedov, Pal'keeva Me, A. A. Az’muko, L. I. Serebryakova, Irina Studneva, M. V. Ovchinnikov, O M Veselova, Oleg I. Pisarenko, Maria Sidorova
Publikováno v:
Russian Journal of Bioorganic Chemistry. 45:353-360
New peptide analogs of galanin corresponding to fragments of the N-terminal sequence were synthesized by an automatic solid-phase method using Fmoc-technology. Incomplete cleavage of the Boc-protection from the Trp indole ring was found during postsy
Autor:
Irina Studneva, O M Veselova, Oleg I. Pisarenko, A. S. Molokoedov, M. V. Ovchinnikov, Maria Sidorova, Pal'keeva Me, R O Lubimov
Publikováno v:
Biochemistry (Moscow), Supplement Series B: Biomedical Chemistry. 13:167-172
The clinical application of the anticancer agent doxorubicin (Dox) is limited due to its cardiotoxic effect. Using the method of automated solid-phase peptide synthesis, we obtained a synthetic agonist of galanin receptors GalR1-3 [βAla14, His15]-ga
Publikováno v:
Pflügers Archiv - European Journal of Physiology. 471:583-593
Disturbed homeostasis of nitric oxide (NO) is one of the causes of myocardial ischemia/reperfusion (I/R) injury during open-heart surgery. This study was designed to explore mechanisms of action of dinitrosyl iron complexes with reduced glutathione (
Autor:
Pal'keeva Me, M. V. Ovchinnikov, Irina Studneva, Maria Sidorova, O M Veselova, R O Lubimov, A. S. Molokoedov, Oleg I. Pisarenko
Publikováno v:
Biomeditsinskaya Khimiya. 65:51-56
The use of the anticancer drug doxorubicin (Dox) is limited due to its cardiotoxic effect. Using the method of automatic solid-phase peptide synthesis, we obtained a synthetic agonist of galanin receptors GalR1-3 [RAla14, His15]-galanine (2-15) (G),