Zobrazeno 1 - 10
of 31
pro vyhledávání: '"O M Veselova"'
Autor:
L. I. Serebryakova, I. M. Studneva, O. M. Veselova, I. V. Dobrokhotov, G. G. Konovalova, A. A. Timoshin, A. A. Abramov, D. V. Avdeev, M. V. Sidorova, V. Z. Lankin, O. I. Pisarenko
Publikováno v:
Biochemistry (Moscow), Supplement Series B: Biomedical Chemistry. 16:340-352
Autor:
M. V. Sidorova, M. E. Palkeeva, D. V. Avdeev, I. M. Studneva, L. I. Serebryakova, O. M. Veselova, I. V. Dobrokhotov, A. S. Molokoedov, O. I. Pisarenko
Publikováno v:
Russian Journal of Bioorganic Chemistry. 48:1020-1026
Publikováno v:
Bulletin of the Russian Military Medical Academy. 23:229-238
This paper presents the history of the formation of the Research Department of the Experimental Medicine of the Research Center of the Military Medical Academy named after S.M. Kirov. The department is the only division of the academy that conducts e
Autor:
A. S. Molokoedov, Pal'keeva Me, A. A. Az’muko, D. V. Avdeev, L. I. Serebryakova, M. V. Ovchinnikov, Oleg I. Pisarenko, Irina Studneva, O M Veselova, Maria Sidorova
Publikováno v:
Russian Journal of Bioorganic Chemistry. 46:32-42
The full-length rat galanin (GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2, G29) was prepared by the solid phase peptide synthesis using the Fmoc-strategy. The peptide chain was elongated both by one amino acid and by a fragment condensation. Fragments with the
Autor:
L. I. Serebryakova, M. E. Pal’keeva, I. M. Studneva, M. V. Ovchinnikov, O. M. Veselova, A. S. Molokoedov, A. A. Az’muko, E. V. Arzamastsev, E. Yu. Afanasyeva, O. A. Terekhova, M. V. Sidorova, O. I. Pisarenko
Publikováno v:
Biochemistry (Moscow), Supplement Series B: Biomedical Chemistry. 13:349-356
Autor:
A. S. Molokoedov, Pal'keeva Me, A. A. Az’muko, L. I. Serebryakova, Irina Studneva, M. V. Ovchinnikov, O M Veselova, Oleg I. Pisarenko, Maria Sidorova
Publikováno v:
Russian Journal of Bioorganic Chemistry. 45:353-360
New peptide analogs of galanin corresponding to fragments of the N-terminal sequence were synthesized by an automatic solid-phase method using Fmoc-technology. Incomplete cleavage of the Boc-protection from the Trp indole ring was found during postsy
Autor:
Irina Studneva, O M Veselova, Oleg I. Pisarenko, A. S. Molokoedov, M. V. Ovchinnikov, Maria Sidorova, Pal'keeva Me, R O Lubimov
Publikováno v:
Biochemistry (Moscow), Supplement Series B: Biomedical Chemistry. 13:167-172
The clinical application of the anticancer agent doxorubicin (Dox) is limited due to its cardiotoxic effect. Using the method of automated solid-phase peptide synthesis, we obtained a synthetic agonist of galanin receptors GalR1-3 [βAla14, His15]-ga
Autor:
Pal'keeva Me, M. V. Ovchinnikov, Irina Studneva, Maria Sidorova, O M Veselova, R O Lubimov, A. S. Molokoedov, Oleg I. Pisarenko
Publikováno v:
Biomeditsinskaya Khimiya. 65:51-56
The use of the anticancer drug doxorubicin (Dox) is limited due to its cardiotoxic effect. Using the method of automatic solid-phase peptide synthesis, we obtained a synthetic agonist of galanin receptors GalR1-3 [RAla14, His15]-galanine (2-15) (G),
Autor:
E V Murzina, O M Veselova, A. S. Simbirtsev, V. V. Zatsepin, A. M. Ishchenko, G A Sofronov, N. V. Aksenova, T. O. Antipova
Publikováno v:
Pharmaceutical Chemistry Journal. 52:835-838
The radioprotective efficacy of recombinant flagellin (FL) and interleukin-1 beta (IL-1) administered in combinations for preventive or therapeutic purposes was studied in experiments on white mongrel mice. The drugs were administered i.p. at doses o
Publikováno v:
Medical academic journal. 18:77-84
Research objective. To evaluate the radioprotective effectiveness of recombinant flagellin when used alone or in combination with interleukin-1 beta for prophylactic or therapeutic effect on animals. Materials and methods. The effect of hybrid flagel