Zobrazeno 1 - 10
of 32
pro vyhledávání: '"Michel Devleeschouwer"'
Publikováno v:
Journal of Microbiological Methods. 82:243-248
article i nfo Article history: Aims: The purpose of this work was to study the initial steps of formation of a biofilm using the BioFilm Ring Test ® and the Crystal violet staining technique. Methods and results: Eight strains of Pseudomonas aerugin
Publikováno v:
Journal of Planar Chromatography – Modern TLC. 23:245-249
TLC-bioautography, a convenient and simple mean of testing plant extracts and pure substances for their effects on pathogenic microorganisms, enables easy detection of active fractions. Its application requires a medium fluid enough to cast suspensio
Autor:
Michel Devleeschouwer, Jean-Paul Dehaye, Paul B. Savage, Malika El-Ouaaliti, Marie Tré-Hardy, Carole Nagant
Publikováno v:
Applied Microbiology and Biotechnology. 88:251-263
The bactericidal activity of a cholic acid antimicrobial derivative, CSA-13, was tested against eight strains of Pseudomonas aeruginosa (both reference and clinical strains) and compared with the response to tobramycin. In planktonic cultures, the mi
Autor:
Michel Devleeschouwer, Naïma El Manssouri, Hamidou Traore, Marie Tré-Hardy, Francis Vanderbist, Mario Vaneechoutte
Publikováno v:
International Journal of Antimicrobial Agents. 34:370-374
Pseudomonas aeruginosa colonisation and chronic lung infection associated with biofilm formation is a major cause of morbidity and mortality in cystic fibrosis (CF) patients. There is thus an urgent need to develop alternative ways to treat biofilm-a
Autor:
Marie Tré-Hardy, Naïma El Manssouri, Michel Devleeschouwer, Francis Vanderbist, Hamidou Traore, Camille Macé
Publikováno v:
International Journal of Antimicrobial Agents. 33:40-45
The prognosis of patients with cystic fibrosis (CF) has improved dramatically over the last three decades although the majority of patients still die in early adulthood. Infection with Pseudomonas aeruginosa has generally been associated with declini
Publikováno v:
Journal of Ethnopharmacology. 112:476-481
Cordia gilletii De Wild (Boraginaceae) root bark is traditionally used in Democratic Republic of Congo (DRC) for the treatment of various disorders, including malaria, diarrhea, wounds and skin diseases; part of these activities may rely on antimicro
Autor:
Michel Vandenbranden, Manuela De Lorenzi, Aida Marino, Michel Devleeschouwer, Stéphanie Pochet, Séverine Tandel, Mikel Garcia-Marcos, Stéphanie Querriére, Marie Tré-Hardy, Jean-Paul Dehaye
Publikováno v:
Molecular Pharmacology. 69:2037-2046
The interaction of mice submandibular gland cells with LL-37 ([LL-37, 37 aa]), a cationic peptide with immunomodulatory properties, was investigated. LL-37 at a concentration that did not affect the integrity of the cells incre
Publikováno v:
International Journal of Pharmaceutics. 197:181-192
Theophylline pellets were coated with Eudragit NE30D aqueous dispersions, containing various pectin HM/Eudragit RL30D ionic complexes, using an Uni-Glatt fluidized-bed apparatus. Dissolution studies were then carried out on the coated pellets at pH 6
Publikováno v:
International Journal of Pharmaceutics. 197:169-179
Theophylline pellets were coated with cellulosic (Aquacoat ECD 30, Surelease clear) or acrylic (Eudragit NE30D, RS30D) polymer aqueous dispersions, containing 10% (related to the insoluble polymer content) of pectin HM or calcium pectinate, using a U
Publikováno v:
International Journal of Pharmaceutics. 174:233-241
Investigations intended to combine pectin HM or calcium pectinates with commercially available aqueous polymer dispersions for colon-specific drug delivery have been conducted on isolated films. The mixed films were prepared from Aquacoat® ECD 30, S