Zobrazeno 1 - 9
of 9
pro vyhledávání: '"Dumas, Michael L."'
Autor:
James Whelan, Melanie Madanat, Joanne M. Buxton, Dumas Michael L, Jun Ouyang, Irene Tom, Clark Pan, Vivian Lee, Joanne Severs, John Andersen
A pEGylated glucagon-like peptide-1 (GLP-1) agonist and glucagon antagonist hybrid peptide was engineered as a potential treatment for type 2 diabetes. To support preclinical development of this PEGylated dual-acting peptide for diabetes (DAPD), we d
Externí odkaz:
https://explore.openaire.eu/search/publication?articleId=doi_dedup___::171bfa6e3a5609cc22b6a6733e4f9826
https://europepmc.org/articles/PMC2751412/
https://europepmc.org/articles/PMC2751412/
Autor:
Stephanie L. Yung, Y. John Wang, James Whelan, Dumas Michael L, Steve Roczniak, Fugang Li, Clark Q. Pan, Thomas H. Claus, Wayne A. Froland, Yaxin Li, Irene Tom, Wei Wang
Publikováno v:
The Journal of pharmacology and experimental therapeutics. 320(2)
A previously described VPAC2-selective agonist, BAY 55-9837 (peptide HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY), had several limitations with respect to its potential as an insulin secretagogue for the treatment of type 2 diabetes. These limitations were prima
Externí odkaz:
https://explore.openaire.eu/search/publication?articleId=doi_dedup___::a0e074d691d63929fcecaa922b34a46f
https://pubmed.ncbi.nlm.nih.gov/17110523
https://pubmed.ncbi.nlm.nih.gov/17110523
Autor:
Brown, Adrienne M., Dumas, Michael L., Reimer, Charles B., Louie, Robert E., Harmon, Richard C.
Publikováno v:
Vox Sanguinis; Dec1984, Vol. 47 Issue 6, p412-420, 9p
Autor:
Galloway, Cynthia J., Madanat, Melanie S., Sarr, Timothy, Espevik, Terje, Dumas, Michael L., Mitra, George, Ranges, Gerald E.
Publikováno v:
European Journal of Immunology; Nov1992, Vol. 22 Issue 11, p3045-3048, 4p
Publikováno v:
Biologicals; March 1994, Vol. 22 Issue: 1 p13-19, 7p
Publikováno v:
In Journal of Chromatography A 1990 512:213-218
Publikováno v:
In Clinica Chimica Acta 1974 55(3):383-388
Publikováno v:
In BBA - Protein Structure 1976 446(1):87-95
Autor:
Schroeder, Duane D., Dumas, Michael L.
Publikováno v:
In The American Journal of Medicine 1984 76(3) Part 1:33-39