Zobrazeno 1 - 10
of 135
pro vyhledávání: '"Az'muko, A. A."'
Autor:
Klimovich, P.S., Semina, E.V. *, Karagyaur, M.N., Rysenkova, K.D., Sysoeva, V.Yu., Mironov, N.A., Sagaradze, G.D., Az'muko, A.A., Popov, V.S., Rubina, K.A., Tkachuk, V.A.
Publikováno v:
In Biomedicine & Pharmacotherapy May 2020 125
Autor:
Maria Sidorova, Alexander A. Timoshin, Irina Studneva, M. V. Ovchinnikov, L. I. Serebryakova, A. S. Molokoedov, A. A. Az’muko, Oksana Veselova, Oleg I. Pisarenko, Pal'keeva Me
Publikováno v:
International Journal of Peptide Research and Therapeutics. 27:2039-2048
Natural and chemically modified N-terminal galanin fragments (WTLNSAGYLLGPHA-OH (G1) and WTLNSAGYLLGPβAH-OH (G2), respectively) reduce functional and metabolic disturbances in the heart during experimental ischemia and reperfusion. The aim of this w
Autor:
A. A. Az’muko, A. S. Molokoedov, Maria Sidorova, M. V. Ovchinnikov, U S Dudkina, E. V. Kudryavtseva, D. V. Avdeev, Pal'keeva Me, Tatiana I. Arefieva, V. N. Bushuev, S. B. Grechishnikov
Publikováno v:
Russian Journal of Bioorganic Chemistry. 46:520-529
The solid phase synthesis (SPS) of the ingramon peptide antagonist of the human monocyte chemoattractant protein-1 (H-Asp-His-Leu-Asp-Lys-Gln-Thr-Gln-Thr-Pro-Lys-Thr-OH), which exhibited the anti-inflammatory activity, was optimized. Side products of
Autor:
A. S. Molokoedov, Pal'keeva Me, A. A. Az’muko, D. V. Avdeev, L. I. Serebryakova, M. V. Ovchinnikov, Oleg I. Pisarenko, Irina Studneva, O M Veselova, Maria Sidorova
Publikováno v:
Russian Journal of Bioorganic Chemistry. 46:32-42
The full-length rat galanin (GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2, G29) was prepared by the solid phase peptide synthesis using the Fmoc-strategy. The peptide chain was elongated both by one amino acid and by a fragment condensation. Fragments with the
Autor:
L. I. Serebryakova, M. E. Pal’keeva, I. M. Studneva, M. V. Ovchinnikov, O. M. Veselova, A. S. Molokoedov, A. A. Az’muko, E. V. Arzamastsev, E. Yu. Afanasyeva, O. A. Terekhova, M. V. Sidorova, O. I. Pisarenko
Publikováno v:
Biochemistry (Moscow), Supplement Series B: Biomedical Chemistry. 13:349-356
Autor:
E S Mironova, T V Sharf, Sergey P. Golitsyn, A. S. Molokoedov, Молокоедов Александр Сергеевич (Ru), A. A. Az’muko, Kirill Zykov, N. A. Mironova, E E Efremov, Азьмуко Андрей Андреевич (Ru)
Publikováno v:
Терапевтический архив, Vol 91, Iss 9, Pp 101-107 (2019)
We aimed to assess autoantibodies to M2-cholinoceptors (M2-CR) in patients with paroxysmal lone atrial fibrillation (AF) and in patients with AF and arterial hypertension (AH).100 patients with lone AF and 84 patients with AF and AH were included. Pa
Autor:
A. S. Molokoedov, Pal'keeva Me, A. A. Az’muko, L. I. Serebryakova, Irina Studneva, M. V. Ovchinnikov, O M Veselova, Oleg I. Pisarenko, Maria Sidorova
Publikováno v:
Russian Journal of Bioorganic Chemistry. 45:353-360
New peptide analogs of galanin corresponding to fragments of the N-terminal sequence were synthesized by an automatic solid-phase method using Fmoc-technology. Incomplete cleavage of the Boc-protection from the Trp indole ring was found during postsy
Autor:
A. A. Az’muko, M. V. Ovchinnikov, A. S. Molokoedov, Oleg I. Pisarenko, V. N. Bushuev, Pal'keeva Me, Maria Sidorova
Publikováno v:
Russian Journal of Bioorganic Chemistry. 45:18-26
A method for the solid-phase synthesis of the apelin-12 analog has been developed using the Fmoc methodology in combination with the temporary protection of the guanidine function of the arginine residues by protonation (salt formation) during the fo
Akademický článek
Tento výsledek nelze pro nepřihlášené uživatele zobrazit.
K zobrazení výsledku je třeba se přihlásit.
K zobrazení výsledku je třeba se přihlásit.
Autor:
M. V. Ovchinnikov, Sidorova Mv, Sergey P. Golitsyn, A. A. Az’muko, T V Sharf, Pal'keeva Me, A S Molokoedov, E E Efremov
Publikováno v:
Russian Journal of Bioorganic Chemistry. 43:351-358
The P26 peptide corresponding to the 197–222 sequence of the second extracellular loop of the β1-adrenoreceptor (β1-AR) was synthesized by solid-phase fragment condensation on the Wang polymer. Pentapeptide fragments were prepared on the 2-chloro