Zobrazeno 1 - 10
of 12
pro vyhledávání: '"A. S. Budikhina"'
Autor:
Vladimir V. Murugin, Nina E. Murugina, Boris V. Pinegin, Viktoriya S. Sharova, Anna M. Nikolaeva, Polina Maximchik, Anna S. Budikhina, Georgy Z. Chkadua, Mikhail Pashenkov, Lyudmila S. Balyasova, M V Melnikov, Yulia A. Dagil
Publikováno v:
J Biol Chem
Upon activation with pathogen-associated molecular patterns, metabolism of macrophages and dendritic cells is shifted from oxidative phosphorylation to aerobic glycolysis, which is considered important for proinflammatory cytokine production. Fragmen
Autor:
Ivan A Molodtsov, Evgenii Kegeles, Alexander N Mitin, Olga Mityaeva, Oksana E Musatova, Anna E Panova, Mikhail V Pashenkov, Iuliia O Peshkova, Almaqdad Alsalloum, Walaa Asaad, Anna S Budikhina, Alexander S Deryabin, Inna V Dolzhikova, Ioanna N Filimonova, Alexandra N Gracheva, Oxana I Ivanova, Anastasia Kizilova, Viktoria V Komogorova, Anastasia Komova, Natalia I Kompantseva, Ekaterina Kucheryavykh, Denis А Lagutkin, Yakov A Lomakin, Alexandra V Maleeva, Elena V Maryukhnich, Afraa Mohammad, Vladimir V Murugin, Nina E Murugina, Anna Navoikova, Margarita F Nikonova, Leyla A Ovchinnikova, Yana Panarina, Natalia V Pinegina, Daria M Potashnikova, Elizaveta V Romanova, Aleena A Saidova, Nawar Sakr, Anastasia G Samoilova, Yana Serdyuk, Naina T Shakirova, Nina I Sharova, Saveliy A Sheetikov, Anastasia F Shemetova, Liudmila V Shevkova, Alexander V Shpektor, Anna Trufanova, Anna V Tvorogova, Valeria M Ukrainskaya, Anatoliy S Vinokurov, Daria A Vorobyeva, Ksenia V Zornikova, Grigory A Efimov, Musa R Khaitov, Ilya A Kofiadi, Alexey A Komissarov, Denis Y Logunov, Nelli B Naigovzina, Yury P Rubtsov, Irina A Vasilyeva, Pavel Volchkov, Elena Vasilieva
Publikováno v:
Clinical infectious diseases : an official publication of the Infectious Diseases Society of America. 75(1)
Background During the ongoing coronavirus disease 2019 (COVID-19) pandemic, many individuals were infected with and have cleared the virus, developing virus-specific antibodies and effector/memory T cells. An important unanswered question is what lev
Autor:
Ya. V. Makarova, Irina V. Shelukhina, Igor Ivanov, Maxim N. Zhmak, O. P. Bychkova, V. G. Arzumanian, A. S. Budikhina, L. S. Balyasova, A. S. Trenin, Victor I. Tsetlin
Publikováno v:
Russian Journal of Bioorganic Chemistry. 45:89-100
Polypeptide SE-33 (SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFF), which is a retro analog of natural antimicrobial protein cathelicidin LL-37 ([LL-37, 37 aa]), was synthesized by the method of solid-phase peptide synthesis. Similar to the
Autor:
Yulia G Pashchenkova, Lyudmila S. Balyasova, Anna S. Budikhina, Anna M. Nikolaeva, Vladimir V. Murugin, Mikhail Pashenkov, Yulia A. Dagil, Georgy Z. Chkadua, Boris V. Pinegin, Nina E. Murugina, Polina Maximchik, Elizaveta M Selezneva
Publikováno v:
Journal of immunology (Baltimore, Md. : 1950). 206(9)
Interactions between pattern-recognition receptors shape innate immune responses to pathogens. NOD1 and TLR4 are synergistically interacting receptors playing a pivotal role in the recognition of Gram-negative bacteria. However, mechanisms of their c
Publikováno v:
Journal of leukocyte biology. 105(4)
Interactions between pattern recognition receptors (PRRs) shape innate immune responses to particular classes of pathogens. Here, we review interactions between TLRs and nucleotide-binding oligomerization domain 1 and 2 (NOD1 and NOD2) receptors, two
Publikováno v:
Russian Journal of Allergy. 7:25-30
Background. The purpose was to investigate a-defensin levels in neutrophiles of pyodermia patients in comparison with healthy donors, to estimate clinical efficiency of glucosaminyl muramyl dipeptide (Licopid) and its influence on a-defensin levels.
Publikováno v:
Russian Journal of Allergy. 7:43-47
The purpose of research. The purpose was to investigate alpha-defensin levels in the circularly neutrophiles of atopic dermatitis and pyodermia patients in comparison with healthy donors. Materials and methods. 27 patients with atopic dermatitis, 31
Autor:
A S Budikhina, В V Pinegin
Publikováno v:
Russian Journal of Allergy. 7:5-12
Cathelicidins are a family of cationic amphipathic antimicrobial polypeptides, which play an important role in innate and adaptive immunity. The knowledge of biological effects of these peptides allows to use them not only as an alternative to common
Autor:
A S Budikhina, B V Pinegin
Publikováno v:
Russian Journal of Allergy. 5:15-21
Autor:
K M, Magomedova, M Z, Saidov, Kh Sh, Davudov, Iu A, Dzhamaludinov, S V, Klimova, A S, Budikhina, I I, Nazhmudinov
Publikováno v:
Vestnik otorinolaringologii. (3)
Results of the study on adaptive immunity in patients with polypous rhinosinusitis (PRS) proved to depend on the degree of eosinophilia in the peripheral blood. The patients were allocated to two groups, one comprised of those having up to 150 eosino